FOXO4 (10mg)
100 in stock
For laboratory research use only. Not for human consumption. Must be 18+ to purchase.
| Form | Powder (lyophilized) |
| CAS Number | 2460055-10-9 |
| Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG |
| Other Names | FOXO4-DRI |
| Weight | 10mg |
| Molecular Weight | 5358.05 g/mol |
Why Choose MD Innovate Peptides ?
Every order backed by science, transparency, and quality
🔬 Third-Party Lab Tested
Every batch independently tested by a certified third-party laboratory using HPLC analysis.
- Purity ≥ 99% guaranteed
- Weight accuracy verified
- Sterility tested
- Endotoxins (LPS) tested
🚀 Fast, Reliable Shipping
Same-day shipping on orders placed before 1:00 PM EST, with optional cold-pack insulated packaging.
- Same-day shipping available
- Free shipping over For orders over $200
- Insulated packaging option
- Full order tracking